PDB entry 2kfk

View 2kfk on RCSB PDB site
Description: Solution structure of Bem1p PB1 domain complexed with Cdc24p PB1 domain
Class: signaling protein
Keywords: PB1, budding, yeast, Phox, SIGNALING PROTEIN
Deposited on 2009-02-23, released 2009-10-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bud emergence protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29366 (3-77)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d2kfka_
  • Chain 'B':
    Compound: Cell division control protein 24
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11433 (3-85)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d2kfkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kfkA (A:)
phmkttkikfyykddifalmlkgdttykelrskiapridtdnfklqtklfdgsgeeiktd
sqvsniiqaklkisvhdi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kfkB (B:)
plgsilfrisynseiftllvekvwnfddlimainskisnthispitkikyqdedgdfvvl
gsdedwnvakemlaennekflnirly