PDB entry 2kf6

View 2kf6 on RCSB PDB site
Description: Barnase bound to d(CGAC) high pressure
Class: hydrolase
Keywords: barnase, ribonuclease, pressure, Endonuclease, Hydrolase, Nuclease, Secreted
Deposited on 2009-02-11, released 2009-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-08, with a file datestamp of 2009-12-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • engineered (101)
    Domains in SCOPe 2.06: d2kf6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kf6A (A:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kf6A (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir