PDB entry 2kf4

View 2kf4 on RCSB PDB site
Description: Barnase high pressure structure
Class: hydrolase
Keywords: barnase, ribonuclease, pressure, Endonuclease, Hydrolase, Nuclease, Secreted, SIGNALING PROTEIN
Deposited on 2009-02-11, released 2009-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • engineered (101)
    Domains in SCOPe 2.08: d2kf4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kf4A (A:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kf4A (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir