PDB entry 2kf2

View 2kf2 on RCSB PDB site
Description: Solution NMR structure of of Streptomyces coelicolor polyketide cyclase SCO5315. Northeast Structural Genomics Consortium target RR365
Class: structural genomics, unknown function
Keywords: aromatase/cyclase, ARO/CYC, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2009-02-11, released 2009-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative polyketide cyclase
  Species: Streptomyces coelicolor A3(2) [TaxId:100226]
  Gene: SC6G9.18, SCO5315
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23154 (0-158)
    • see remark 999 (19)
    • expression tag (159-166)
  Domains in SCOPe 2.07: d2kf2a1, d2kf2a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kf2A (A:)
  maghtdneitiaapmelvwtmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg
  kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv
  ddawmtdninrnsrtqmalirdrieqaagerrtasvladlehhhhhh