PDB entry 2ke5

View 2ke5 on RCSB PDB site
Description: Solution structure and dynamics of the small GTPase Ralb in its active conformation: significance for effector protein binding
Class: signaling protein
Keywords: Ral, Cancer, Signalling, G protein, GTPase, Cell membrane, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Prenylation, SIGNALING PROTEIN
Deposited on 2009-01-23, released 2009-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-B
    Species: Homo sapiens [TaxId:9606]
    Gene: RALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11234 (0-173)
      • engineered (60)
    Domains in SCOPe 2.06: d2ke5a_
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ke5A (A:)
    lalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtag
    ledyaairdnyfrsgegfllvfsitehesftataefreqilrvkaeedkipllvvgnksd
    leerrqvpveearskaeewgvqyvetsaktranvdkvffdlmreirtkkmsenk