PDB entry 2kdz

View 2kdz on RCSB PDB site
Description: Structure of the R2R3 DNA binding domain of MYB1 protein from protozoan parasite trichomonas vaginalis in complex with MRE-1/MRE-2R DNA
Class: transcription/DNA
Keywords: Myb1, R2R3 Domain, DNA-binding, Nucleus, TRANSCRIPTION/DNA COMPLEX
Deposited on 2009-01-21, released 2009-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myb24
    Species: Trichomonas vaginalis [TaxId:5722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2kdza1, d2kdza2
  • Chain 'B':
    Compound: 5'-d(*ap*ap*gp*ap*tp*ap*ap*cp*gp*ap*tp*ap*tp*tp*tp*a)-3'
  • Chain 'C':
    Compound: 5'-d(*tp*ap*ap*ap*tp*ap*tp*cp*gp*tp*tp*ap*tp*cp*tp*t)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kdzA (A:)
    kvkfteeedlklqqlvmrygakdwirisqlmitrnprqcrerwnnyinpalrtdpwspee
    dmlldqkyaeygpkwnkiskflknrsdnnirnrwmmiarhrakhqks
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.