PDB entry 2kdg

View 2kdg on RCSB PDB site
Description: Solution Structure of the 1st Ig domain of Myotilin
Class: structural protein
Keywords: Myotilin, Immonoglobulin domain, actin-binding, STRUCTURAL PROTEIN, Cell membrane, Cytoplasm, Cytoskeleton, Disease mutation, Immunoglobulin domain, Limb-girdle muscular dystrophy, Membrane, Muscle protein, Polymorphism
Deposited on 2009-01-08, released 2009-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myotilin
  Species: Homo sapiens [TaxId:9606]
  Gene: MYOT, TTID
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBF9 (4-99)
    • expression tag (0-3)
  Domains in SCOPe 2.06: d2kdga1, d2kdga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kdgA (A:)
  gamgpprfiqvpenmsidegrfcrmdfkvsglpapdvswylngrtvqsddlhkmivsekg
  lhslifevvrasdagayacvaknrageatftvqldvlake