PDB entry 2kd0

View 2kd0 on RCSB PDB site
Description: NMR solution structure of O64736 protein from Arabidopsis thaliana. Northeast Structural Genomics Consortium MEGA Target AR3445A
Class: signaling protein
Keywords: Ubiquitin-like protein, NESG, AR3445A, Leucine-rich repeat, STRUCTURAL GENOMICS, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, SIGNALING PROTEIN
Deposited on 2008-12-31, released 2009-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: LRR repeats and ubiquitin-like domain-containing protein At2g30105
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: At2g30105, T27E13.16
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C895 (10-84)
    • expression tag (0-9)
  Domains in SCOPe 2.08: d2kd0a1, d2kd0a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kd0A (A:)
  mghhhhhhshstikltvkfggksiplsvspdctvkdlksqlqpitnvlprgqklifkgkv
  lvetstlkqsdvgsgaklmlmasqg