PDB entry 2kcg

View 2kcg on RCSB PDB site
Description: Solution structure of cycloviolacin O2
Class: plant protein
Keywords: cyclic cystine knot, Cytolysis, Hemolysis, Knottin, Plant defense, PLANT PROTEIN
Deposited on 2008-12-22, released 2009-07-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cycloviolacin-O2
  Species: Viola odorata [TaxId:97441]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P58434 (0-29)
  Domains in SCOPe 2.04: d2kcga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kcgA (A:)
  gipcgescvwipcissaigcsckskvcyrn