PDB entry 2kcg

View 2kcg on RCSB PDB site
Description: Solution structure of cycloviolacin O2
Class: plant protein
Keywords: cyclic cystine knot, Cytolysis, Hemolysis, Knottin, Plant defense, PLANT PROTEIN
Deposited on 2008-12-22, released 2009-07-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cycloviolacin-O2
    Species: Viola odorata [TaxId:97441]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2kcga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kcgA (A:)
    gipcgescvwipcissaigcsckskvcyrn