PDB entry 2kcf

View 2kcf on RCSB PDB site
Description: The NMR solution structure of the isolated Apo Pin1 WW domain
Class: isomerase
Keywords: isomerase, peptidylprolyl isomerase, Pin1, WW domain, Cell cycle, Nucleus, Phosphoprotein, Rotamase
Deposited on 2008-12-19, released 2009-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-13, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (2-35)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2kcfa1, d2kcfa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kcfA (A:)
    gsklppgwekrmsrssgrvyyfnhitnasqwerpsg