PDB entry 2kbm

View 2kbm on RCSB PDB site
Description: Ca-S100A1 interacting with TRTK12
Class: metal binding protein
Keywords: S100, EF-hand, Protein-protein interaction, conformational change, CapZ, Acetylation, Actin capping, Actin-binding, Calcium, Cytoplasm, Metal-binding, Zinc, METAL BINDING PROTEIN
Deposited on 2008-12-02, released 2009-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100a1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kbma_
  • Chain 'B':
    Compound: Protein S100-A1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100a1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kbmb_
  • Chain 'X':
    Compound: F-actin-capping protein subunit alpha-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Capza2
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: F-actin-capping protein subunit alpha-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Capza2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kbmA (A:)
    gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
    ldengdgevdfqefvvlvaaltvacnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kbmB (B:)
    gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
    ldengdgevdfqefvvlvaaltvacnnffwens
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.