PDB entry 2kbg
View 2kbg on RCSB PDB site
Description: Solution structure of the second Fibronectin type-III module of NCAM2
Class: cell adhesion
Keywords: Cell adhesion molecule, fibronectin type III module, NCAM2, beta-sheet sandwich, Cell membrane, Glycoprotein, Immunoglobulin domain, Membrane, Phosphoprotein, Transmembrane
Deposited on
2008-11-28, released
2009-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-12-01, with a file datestamp of
2009-11-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Neural cell adhesion molecule 2
Species: Homo sapiens [TaxId:9606]
Gene: NCAM2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2kbga_
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2kbgA (A:)
eaeasmrepsppsihgqpssgksfklsitkqddggapileyivkyrskdkedqwlekkvq
gnkdhiilehlqwtmgyevqitaanrlgyseptvyefsmppkpniikdhhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2kbgA (A:)
repsppsihgqpssgksfklsitkqddggapileyivkyrskdkedqwlekkvqgnkdhi
ilehlqwtmgyevqitaanrlgyseptvyefsmppkpniikd