PDB entry 2kbg

View 2kbg on RCSB PDB site
Description: Solution structure of the second Fibronectin type-III module of NCAM2
Class: cell adhesion
Keywords: Cell adhesion molecule, fibronectin type III module, NCAM2, beta-sheet sandwich, Cell membrane, Glycoprotein, Immunoglobulin domain, Membrane, Phosphoprotein, Transmembrane
Deposited on 2008-11-28, released 2009-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural cell adhesion molecule 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCAM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2kbga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kbgA (A:)
    eaeasmrepsppsihgqpssgksfklsitkqddggapileyivkyrskdkedqwlekkvq
    gnkdhiilehlqwtmgyevqitaanrlgyseptvyefsmppkpniikdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kbgA (A:)
    repsppsihgqpssgksfklsitkqddggapileyivkyrskdkedqwlekkvqgnkdhi
    ilehlqwtmgyevqitaanrlgyseptvyefsmppkpniikd