PDB entry 2kb6

View 2kb6 on RCSB PDB site
Description: Solution structure of onconase C87A/C104A
Class: Hydrolase
Keywords: protein, RNase, Endonuclease, Hydrolase, Nuclease, Pyrrolidone carboxylic acid
Deposited on 2008-11-21, released 2009-11-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein P-30
  Species: Rana pipiens [TaxId:8404]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22069 (0-103)
    • engineered (0)
    • engineered (86)
    • engineered (103)
  Domains in SCOPe 2.05: d2kb6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kb6A (A:)
  edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
  sefylsdcnvtsrpckyklkkstnkfavtcenqapvhfvgvgsa