PDB entry 2ka4

View 2ka4 on RCSB PDB site
Description: NMR structure of the CBP-TAZ1/STAT2-TAD complex
Class: Transcription regulator
Keywords: CBP/p300, STAT2, TAZ1, transactivation domain, Bromodomain, Activator, Alternative splicing, Antiviral defense, Cytoplasm, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Polymorphism, SH2 domain, Transcription, Transcription regulation, Transcription regulator
Deposited on 2008-10-30, released 2009-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Crebbp protein
  Species: musculus [TaxId:10090]
  Gene: Crebbp
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6GQV9 (0-99)
  Domains in SCOPe 2.08: d2ka4a_
• Chain 'B':
  Compound: Signal transducer and activator of transcription 2
  Species: sapiens [TaxId:9606]
  Gene: STAT2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P52630 (4-56)
    • expression tag (0-3)
    • engineered (11)
    • engineered (27)
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ka4A (A:)
  atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa
  gkacqvahcassrqiishwknctrhdcpvclplknasdkr
  

  
  
• Chain 'B':
  No sequence available.