PDB entry 2k9g

View 2k9g on RCSB PDB site
Description: Solution structure of the third SH3 domain of the Cin85 adapter protein
Class: signaling protein
Keywords: Cin85, SH3, adaptor protein, downregulation, cbl, Apoptosis, Cell junction, Cytoplasmic vesicle, Cytoskeleton, Endocytosis, Membrane, Phosphoprotein, SH3 domain, SH3-binding, Synapse, Synaptosome, SIGNALING PROTEIN
Deposited on 2008-10-10, released 2009-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 domain-containing kinase-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CIN85, SH3KBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96B97 (1-72)
      • expression tag (0)
    Domains in SCOPe 2.06: d2k9ga1, d2k9ga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k9gA (A:)
    smdsrtkskdyckvifpyeaqnddeltikegdivtlinkdcidvgwwegelngrrgvfpd
    nfvkllppdfeke