PDB entry 2k9d

View 2k9d on RCSB PDB site
Description: Solution structure of the domain X of measle phosphoprotein
Class: viral protein
Keywords: measle, Morbillivirus, phosphoprotein, X Domain, RNA editing, RNA replication, VIRAL PROTEIN
Deposited on 2008-10-08, released 2009-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphoprotein
  Species: Measles virus [TaxId:11234]
  Gene: P/V
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03422 (0-43)
    • conflict (40)
  Domains in SCOPe 2.08: d2k9da_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k9dA (A:)
  svirsiikssrleedrkrylmtllddikgandlakfhqmlvkii