PDB entry 2k9c

View 2k9c on RCSB PDB site
Description: Paramagnetic shifts in solid-state NMR of Proteins to elicit structural information
Class: hydrolase
Keywords: Matrix metalloproteinase, Solid-state NMR, pseudocontact shift, paramagnetic NMR, HYDROLASE, Calcium, Extracellular matrix, Glycoprotein, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen
Deposited on 2008-10-08, released 2008-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Gene: MMP12, HME
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (0-151)
    • engineered (59)
  Domains in SCOPe 2.08: d2k9ca_
• Heterogens: CO

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k9cA (A:)
  hyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfargahgdd
  hafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglghssd
  pkavmfptykyvdintfrlsaddirgiqslyg