PDB entry 2k92

View 2k92 on RCSB PDB site
Description: Structural modification of acyl carrier protein by butyryl group
Class: lipid transport
Keywords: Apo Form of Acyl Carrier Protein, Fatty Acid Synthesis Protein, Cytoplasm, Fatty acid biosynthesis, Lipid synthesis, Phosphopantetheine, LIPID TRANSPORT
Deposited on 2008-09-29, released 2009-01-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-01-05, with a file datestamp of 2009-12-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:562]
    Gene: acpP, b1094, JW1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (0-76)
      • conflict (12)
    Domains in SCOPe 2.04: d2k92a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k92A (A:)
    stieervkkiigqqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa