PDB entry 2k8r

View 2k8r on RCSB PDB site
Description: Solution structure of human acidic fibroblast growth factor in complex with anti-angiogenic drug inositol hexaphosphate (IP6)
Class: hormone
Keywords: Acidic Fibroblast growth factor, Acetylation, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, HORMONE
Deposited on 2008-09-22, released 2009-10-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: hFGF-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2k8ra_
  • Heterogens: IHP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k8rA (A:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
    dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
    kailflplpvssd