PDB entry 2k8f

View 2k8f on RCSB PDB site
Description: Structural Basis for the Regulation of p53 Function by p300
Class: Transferase/Transcription
Keywords: Complex of p53 and p300, Acetylation, Bromodomain, Cell cycle, Chromosomal rearrangement, Citrullination, Disease mutation, Host-virus interaction, Metal-binding, Methylation, Nucleus, Phosphoprotein, Polymorphism, Transcription, Transcription regulation, Transferase, Zinc, Zinc-finger, Activator, Alternative splicing, Anti-oncogene, Apoptosis, Covalent protein-RNA linkage, Cytoplasm, DNA-binding, Endoplasmic reticulum, Glycoprotein, Li-Fraumeni syndrome, Ubl conjugation, Transferase/Transcription COMPLEX
Deposited on 2008-09-08, released 2009-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09472 (0-89)
      • engineered (15)
      • engineered (23)
      • engineered (66-67)
    Domains in SCOPe 2.08: d2k8fa_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k8fA (A:)
    atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic
    kqlialaayhakhcqenkcpvpfclnikqk
    

  • Chain 'B':
    No sequence available.