PDB entry 2k8e

View 2k8e on RCSB PDB site
Description: Solution NMR Structure of protein of unknown function yegP from E. coli. Ontario Center for Structural Proteomics target EC0640_1_123 Northeast Structural Genomics Consortium Target ET102.
Class: structural genomics, unknown function
Keywords: YegP, Protein Structure initiative (PSI), Northeast structural genomics consortium (NESG), Ontario Centre for structural proteomics (OCSP), Escherichia Coli, structural genomics, unknown function
Deposited on 2008-09-08, released 2008-10-14
The last revision prior to the SCOP 1.75 freeze date was dated 2008-10-14, with a file datestamp of 2008-10-10.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0339 protein yegP
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: yegP, b2080, JW5339
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76402 (16-125)
      • expression tag (13-15)
      • expression tag (126-128)
    Domains in SCOP 1.75: d2k8ea1, d2k8ea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k8eA (A:)
    qghmlfsihnfnqgvimagwfelskssdnqfrfvlkagngetiltselytsktsaekgia
    svrsnspqeeryekktasngkfyfnlkaanhqiigssqmyataqsretgiasvkangtsq
    tvkdntgsnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k8eA (A:)
    gvimagwfelskssdnqfrfvlkagngetiltselytsktsaekgiasvrsnspqeerye
    kktasngkfyfnlkaanhqiigssqmyataqsretgiasvkangtsqtvkdntgsn