PDB entry 2k7z

View 2k7z on RCSB PDB site
Description: Solution Structure of the Catalytic Domain of Procaspase-8
Class: hydrolase
Keywords: caspase, apoptosis, NMR, initiator caspase, procaspase, Cytoplasm, Hydrolase, Protease, Thiol protease, Zymogen
Deposited on 2008-08-28, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-8
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP8, MCH5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14790 (Start-265)
      • engineered (146)
    Domains in SCOPe 2.07: d2k7za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k7zA (A:)
    mrgsesqtldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagalttt
    feelhfeikphddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapi
    yeltsqftglkcpslagkpkvffiqaaqgdnyqkgipvetdseeqpylemdlsspqtryi
    pdeadfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnyevsnk
    ddkknmgkqmpqptftlrkklvfpsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k7zA (A:)
    kvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfeikp
    hddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqftgl
    kcpslagkpkvffiqaaqgdnyqkgipvetdseeqpylemdlsspqtryipdeadfllgm
    apaegtwyiqslcqslrercprgddiltiltevpqptftlrkklvfpsd