PDB entry 2k7w

View 2k7w on RCSB PDB site
Description: BAX Activation is Initiated at a Novel Interaction Site
Class: apoptosis
Keywords: bax, bim, bh3, bcl-2, apoptosis
Deposited on 2008-08-27, released 2008-10-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Apoptosis regulator BAX
  Species: Homo sapiens [TaxId:9606]
  Gene: BAX
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07812 (0-191)
  Domains in SCOPe 2.03: d2k7wa1
• Chain 'B':
  Compound: Bcl-2-like protein 11
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43521 (0-19)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k7wA (A:)
  mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
  eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
  vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
  ltasltiwkkmg
  

  
  
• Chain 'B':
  No sequence available.