PDB entry 2k7w

View 2k7w on RCSB PDB site
Description: BAX Activation is Initiated at a Novel Interaction Site
Class: apoptosis
Keywords: bax, bim, bh3, bcl-2, apoptosis
Deposited on 2008-08-27, released 2008-10-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Gene: BAX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2k7wa1
  • Chain 'B':
    Compound: Bcl-2-like protein 11
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k7wA (A:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
    ltasltiwkkmg
    

  • Chain 'B':
    No sequence available.