PDB entry 2k7o

View 2k7o on RCSB PDB site
Description: Ca2+-S100B, refined with RDCs
Class: metal binding protein
Keywords: S100 protein, calcium binding, EF-hand, Calcium, Cytoplasm, Metal-binding, Nucleus, Zinc, METAL BINDING PROTEIN
Deposited on 2008-08-17, released 2008-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2k7oa_
  • Chain 'B':
    Compound: Protein S100-B
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2k7ob_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k7oA (A:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dedgdgecdfqefmafvsmvttacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k7oB (B:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dedgdgecdfqefmafvsmvttacheffehe