PDB entry 2k7j

View 2k7j on RCSB PDB site
Description: Human Acylphosphatase(AcPh) surface charge-optimized
Class: hydrolase
Keywords: PROTEIN, Acetylation, Hydrolase
Deposited on 2008-08-12, released 2009-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acylphosphatase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACYP1, ACYPE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07311 (1-98)
      • expression tag (0)
      • engineered (50)
      • engineered (60)
      • engineered (63)
      • engineered (72)
      • engineered (81)
    Domains in SCOPe 2.06: d2k7ja1, d2k7ja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k7jA (A:)
gaegntlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgklqgpiskvr
emqkwletrgspeshidkanfknekvilkldysdfqivk