PDB entry 2k79

View 2k79 on RCSB PDB site
Description: Solution Structure of the binary complex between the SH3 and SH2 domain of interleukin-2 tyrosine kinase
Class: Transferase
Keywords: SH3, SH2, novel, cis, ATP-binding, Cell membrane, Kinase, Membrane, Metal-binding, Nucleotide-binding, Phosphoprotein, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, Zinc, Zinc-finger
Deposited on 2008-08-08, released 2009-03-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 domain of Tyrosine-protein kinase ITK/TSK
    Species: Mus musculus [TaxId:10090]
    Gene: Itk, Emt, Tlk, Tsk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03526 (2-62)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d2k79a_
  • Chain 'B':
    Compound: SH2 domain of Tyrosine-protein kinase ITK/TSK
    Species: Mus musculus [TaxId:10090]
    Gene: Itk, Emt, Tlk, Tsk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03526 (2-108)
      • expression tag (109)
    Domains in SCOPe 2.05: d2k79b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k79A (A:)
gspeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylve
ksp

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2k79B (B:)
gsnnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpci
khyhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg

    Sequence, based on observed residues (ATOM records): (download) 
    >2k79B (B:)
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg