PDB entry 2k6q

View 2k6q on RCSB PDB site
Description: LC3 p62 complex structure
Class: apoptosis inhibitor/apoptosis
Keywords: LC3, p62, Alternative splicing, Autophagy, Cytoplasm, Cytoplasmic vesicle, Lipoprotein, Membrane, Microtubule, Ubl conjugation pathway, Apoptosis, Differentiation, Endosome, Immune response, Metal-binding, Nucleus, Phosphoprotein, Zinc, Zinc-finger, APOPTOSIS INHIBITOR-APOPTOSIS COMPLEX
Deposited on 2008-07-17, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Microtubule-associated proteins 1A/1B light chain 3B
  Species: norvegicus [TaxId:10116]
  Gene: Map1lc3b, Map1alc3, Map1lc3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q62625 (1-120)
    • expression tag (0)
  Domains in SCOPe 2.08: d2k6qa2, d2k6qa3
• Chain 'B':
  Compound: p62_peptide from Sequestosome-1
  Species: norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O08623 (1-16)
    • expression tag (0)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k6qA (A:)
  smpsektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvn
  mselikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetf
  g
  

  
  
• Chain 'B':
  No sequence available.