PDB entry 2k6m

View 2k6m on RCSB PDB site
Description: Solution Structure of Human Supervillin Headpiece
Class: structural protein
Keywords: Supervillin, SVHP, HP, Headpiece, Villin, Archvillin, NMR, Actin capping, Actin-binding, Alternative splicing, Calcium, Cytoplasm, Cytoskeleton, Membrane, Phosphoprotein, Polymorphism, STRUCTURAL PROTEIN
Deposited on 2008-07-11, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Compound: Supervillin
    Species: Homo sapiens [TaxId:9606]
    Gene: SVIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95425 (1-66)
      • expression tag (0)
    Domains in SCOPe 2.07: d2k6ms1, d2k6ms2

PDB Chain Sequences:

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k6mS (S:)
mlaklcktiypladllarplpegvdplkleiyltdedfefaldmtrdeynalpawkqvnl
kkakglf