PDB entry 2k62

View 2k62 on RCSB PDB site
Description: NMR solution structure of the supramolecular adduct between a liver cytosolic bile acid binding protein and a bile acid-based Gd(III)-chelate
Class: lipid binding protein
Keywords: hepatospecific contrast agent, HADDOCK, Gd(III) bile acid adduct, Acetylation, Cytoplasm, Lipid-binding, Transport, LIPID BINDING PROTEIN
Deposited on 2008-07-03, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Liver fatty acid-binding protein
    Species: Gallus gallus [TaxId:9031]
    Gene: FABP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2k62a_
  • Heterogens: YB, ITL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k62A (A:)
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
rskrv