PDB entry 2k57

View 2k57 on RCSB PDB site
Description: Solution NMR Structure of Putative Lipoprotein from Pseudomonas syringae Gene Locus PSPTO2350. Northeast Structural Genomics Target PsR76A.
Class: structural genomics, unknown function
Keywords: putative lipoprotein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Lipoprotein, unknown function
Deposited on 2008-06-25, released 2008-09-30
The last revision prior to the SCOP 1.75 freeze date was dated 2008-09-30, with a file datestamp of 2008-09-26.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative lipoprotein
    Species: Pseudomonas syringae pv. phaseolicola 1448A [TaxId:264730]
    Gene: PSPPH_2109
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48JU9 (1-52)
      • expression tag (0)
      • expression tag (53-54)
    Domains in SCOP 1.75: d2k57a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k57A (A:)
    masptvitlndgreiqavdtpkydeesgfyefkqldgkqtrinkdqvrtvkdllehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k57A (A:)
    masptvitlndgreiqavdtpkydeesgfyefkqldgkqtrinkdqvrtvkdlle