PDB entry 2k4x

View 2k4x on RCSB PDB site
Description: Solution structure of 30S ribosomal protein S27A from Thermoplasma acidophilum
Class: ribosomal protein
Keywords: 30S ribosomal protein S27A, Metal-binding, Ribonucleoprotein, Ribosomal protein, Zinc-finger, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ontario Centre for Structural Proteomics, OCSP
Deposited on 2008-06-20, released 2008-08-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S27ae
    Species: acidophilum [TaxId:2303]
    Gene: rps27ae, Ta1093
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2k4xa1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k4xA (A:)
    mqkrelyeiadgklvrkhrfcprcgpgvflaehadryscgrcgytefkkakksks