PDB entry 2k4j

View 2k4j on RCSB PDB site
Description: ArsR DNA Binding Domain
Class: transcription
Keywords: Response regulator, Helicobacter pylori, acid resistance, DNA-binding, Phosphoprotein, Transcription, Transcription regulation
Deposited on 2008-06-11, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator
    Species: Helicobacter pylori [TaxId:85963]
    Gene: jhp_0152
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZMR6 (12-114)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d2k4ja1, d2k4ja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k4jA (A:)
    mrgshhhhhhgseevsepgdanifrvdkdsrevymhekkldltraeyeilslliskkgyv
    fsresiaiesesinpessnksidviigrlrskieknpkqpqyiisvrgigykley
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k4jA (A:)
    gseevsepgdanifrvdkdsrevymhekkldltraeyeilslliskkgyvfsresiaies
    esinpessnksidviigrlrskieknpkqpqyiisvrgigykley