PDB entry 2k4e

View 2k4e on RCSB PDB site
Description: Solution structure of the HIV-2 UNMYRISTOYLATED MATRIX PROTEIN
Class: structural protein
Keywords: aids, capsid protein, myristate, matrix, gag, hiv, nmr, virion, structural protein, plasma membrane
Deposited on 2008-06-07, released 2008-08-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV-2 unmyristoylated matrix protein
    Species: Human immunodeficiency virus type 2 [TaxId:11720]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2k4ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k4eA (A:)
garnsvlrgkkadelerirlrpggkkkyrlkhivwaankldrfglaeslleskegcqkil
tvldpmvptgsenlkslfntvcviwcihaeekvkdtegakqivrrhlvaetgtaekmpst
srptapssekggny