PDB entry 2k4a
View 2k4a on RCSB PDB site
Description: FGF-1-C2A binary complex structure: a key component in the fibroblast growthfactor non-classical pathway
Class: protein transport
Keywords: beta barrel, FGF1-C2A binary complex, Calcium, Cell junction, Cytoplasmic vesicle, Glycoprotein, Lipoprotein, Membrane, Metal-binding, Palmitate, Phosphoprotein, Synapse, Transmembrane, Acetylation, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, PROTEIN TRANSPORT
Deposited on
2008-06-02, released
2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-06-09, with a file datestamp of
2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Synaptotagmin-1
Species: Homo sapiens [TaxId:9606]
Gene: SYT1, SVP65, SYT
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2k4aa_ - Chain 'B':
Compound: heparin-binding growth factor 1
Species: Homo sapiens [TaxId:9606]
Gene: FGF1, FGFA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2k4ab_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2k4aA (A:)
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2k4aB (B:)
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpvssd