PDB entry 2k4a

View 2k4a on RCSB PDB site
Description: FGF-1-C2A binary complex structure: a key component in the fibroblast growthfactor non-classical pathway
Class: protein transport
Keywords: beta barrel, FGF1-C2A binary complex, Calcium, Cell junction, Cytoplasmic vesicle, Glycoprotein, Lipoprotein, Membrane, Metal-binding, Palmitate, Phosphoprotein, Synapse, Transmembrane, Acetylation, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, PROTEIN TRANSPORT
Deposited on 2008-06-02, released 2009-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT1, SVP65, SYT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2k4aa_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2k4ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k4aA (A:)
    eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
    ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
    rdlqsaek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k4aB (B:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
    dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
    kailflplpvssd