PDB entry 2k40

View 2k40 on RCSB PDB site
Description: NMR structure of HESX-1 homeodomain double mutant R31L/E42L
Class: DNA binding protein
Keywords: THERMOSTABLE HOMEODOMAIN VARIANT, DNA BINDING PROTEIN, Developmental protein, Disease mutation, DNA-binding, Dwarfism, Homeobox, Nucleus, Polymorphism, Transcription, Transcription regulation
Deposited on 2008-05-26, released 2009-05-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox expressed in ES cells 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HESX1, HANF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBX0 (0-66)
      • engineered (30)
      • engineered (41)
    Domains in SCOPe 2.08: d2k40a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k40A (A:)
    grrprtaftqnqievlenvfrvncypgidiledlaqklnleldriqiwfqnrraklkrsh
    resqflm