PDB entry 2k3w

View 2k3w on RCSB PDB site
Description: NMR structure of VPS4A-MIT-CHMP6
Class: protein transport
Keywords: ESRCT-III, NMR, CHMP6, MIT, ATP-binding, Membrane, Nucleotide-binding, Protein transport, Transport, Coiled coil, Endosome, Lipoprotein, Myristate
Deposited on 2008-05-19, released 2008-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associating protein 4A
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS4A, VPS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2k3wa_
  • Chain 'B':
    Compound: Charged multivesicular body protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CHMP6, VPS20
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2k3wA (A:)
mttstlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakc
vqyldraeklkdylrskekhgkkp

    Sequence, based on observed residues (ATOM records): (download) 
    >2k3wA (A:)
tstlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakcvq
yldraeklkdylr

  • Chain 'B':
    No sequence available.