PDB entry 2k3v

View 2k3v on RCSB PDB site
Description: Solution Structure of a Tetrahaem Cytochrome from Shewanella Frigidimarina
Class: electron transport
Keywords: Multihaem cytochromes, Redox proteins, Shewanella, Electron transport, Heme, Iron, Metal-binding, Periplasm, Transport
Deposited on 2008-05-19, released 2009-03-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetraheme cytochrome c-type
    Species: Shewanella frigidimarina [TaxId:318167]
    Gene: cctA, Sfri_1504
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2k3va_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k3vA (A:)
    adetlaefhvemggcenchadgepskdgayefeqcqschgslaemddnhkphdgllmcad
    chapheakvgekptcdtchddgrtak