PDB entry 2k3h

View 2k3h on RCSB PDB site
Description: Structural determinants for Ca2+ and PIP2 binding by the C2A domain of rabphilin-3A
Class: protein transport
Keywords: PIP2, C2 domain, Calcium, TAMA mechanism, Cell junction, Metal-binding, Phosphoprotein, Protein transport, Synapse, Transport, Zinc, Zinc-finger
Deposited on 2008-05-08, released 2008-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rabphilin-3a
    Species: Mus musculus [TaxId:10090]
    Gene: Rph3a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2k3ha_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k3hA (A:)
    eansydsdeattlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpga
    sksnklrtktlrntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfs
    lkklkanqrknfniclervi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k3hA (A:)
    galefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklrtktlrn
    trnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkanqrknfn
    iclervi