PDB entry 2k3g

View 2k3g on RCSB PDB site
Description: NMR structure analysis of a BMP receptor
Class: signaling protein
Keywords: NMR structure, BMP, receptor, TGF-beta superfamily, ATP-binding, Disease mutation, Glycoprotein, Kinase, Magnesium, Manganese, Membrane, Metal-binding, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase, Transmembrane, SIGNALING PROTEIN
Deposited on 2008-05-07, released 2008-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-12-16, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein receptor type-1A
    Species: HOMO SAPIENS
    Gene: BMPR1A, ACVRLK3, ALK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36894 (0-101)
      • engineered (0)
    Domains in SCOPe 2.06: d2k3ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k3gA (A:)
    gpedtlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqc
    kdspkaqlrrtieccrtnlcnqylqptlppvvigpffdgsir