PDB entry 2k2u

View 2k2u on RCSB PDB site
Description: NMR Structure of the complex between Tfb1 subunit of TFIIH and the activation domain of VP16
Class: transcription
Keywords: VP16, TFIIH, Tfb1, Activation, Transcription, PH Domain, NMR, Protein Structure Complex, DNA damage, DNA repair, Nucleus, Transcription regulation, DNA-binding
Deposited on 2008-04-11, released 2008-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 1
    Species: SACCHAROMYCES CEREVISIAE
    Gene: TFB1, YDR311W, D9740.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (0-114)
      • engineered (0)
    Domains in SCOPe 2.07: d2k2ua_
  • Chain 'B':
    Compound: Alpha trans-inducing protein
    Species: Human herpesvirus 1
    Gene: UL48
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k2uA (A:)
    pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
    rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad
    

  • Chain 'B':
    No sequence available.