PDB entry 2k2u

View 2k2u on RCSB PDB site
Description: NMR Structure of the complex between Tfb1 subunit of TFIIH and the activation domain of VP16
Class: transcription
Keywords: VP16, TFIIH, Tfb1, Activation, Transcription, PH Domain, NMR, Protein Structure Complex, DNA damage, DNA repair, Nucleus, Transcription regulation, DNA-binding
Deposited on 2008-04-11, released 2008-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA polymerase II transcription factor B subunit 1
  Species: SACCHAROMYCES CEREVISIAE
  Gene: TFB1, YDR311W, D9740.3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32776 (0-114)
    • engineered (0)
  Domains in SCOPe 2.08: d2k2ua_
• Chain 'B':
  Compound: Alpha trans-inducing protein
  Species: Human herpesvirus 1
  Gene: UL48
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04486 (0-34)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k2uA (A:)
  pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
  rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad
  

  
  
• Chain 'B':
  No sequence available.