PDB entry 2k2q

View 2k2q on RCSB PDB site
Description: complex structure of the external thioesterase of the Surfactin-synthetase with a carrier domain
Class: Ligase/Hydrolase
Keywords: thioesterase, a/b-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, Antibiotic biosynthesis, Ligase, Multifunctional enzyme, Phosphopantetheine, Cytoplasm, Sporulation, Stress response, Ligase/Hydrolase COMPLEX
Deposited on 2008-04-10, released 2008-12-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrocidine synthetase 3 (Tyrocidine synthetase III)
    Species: Brevibacillus parabrevis
    Gene: TYCC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30409 (2-81)
      • expression tag (0-1)
    Domains in SCOPe 2.04: d2k2qa_
  • Chain 'B':
    Compound: Surfactin synthetase thioesterase subunit
    Species: Bacillus subtilis
    Gene: srfAD, srfA4
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k2qA (A:)
mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
velplkvlfaqptikalaqyva

  • Chain 'B':
    No sequence available.