PDB entry 2k2n

View 2k2n on RCSB PDB site
Description: Solution structure of a cyanobacterial phytochrome GAF domain in the red light-absorbing ground state
Class: transferase
Keywords: phytochrome, GAF DOMAIN, phycocyanobilin, PCB, bacteriophytochrome, cyanobacterial phytochrome, Kinase, Phosphoprotein, Transferase
Deposited on 2008-04-04, released 2008-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sensor protein
  Species: Synechococcus sp. [TaxId:316278]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2JIZ5 (0-169)
    • expression tag (170-171)
  Domains in SCOPe 2.08: d2k2na1, d2k2na2
• Heterogens: CYC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k2nA (A:)
  ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
  arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
  slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqaelsl