PDB entry 2k2f

View 2k2f on RCSB PDB site
Description: Solution structure of Ca2+-S100A1-RyRP12
Class: metal binding protein
Keywords: S100, EF hand, ryanodine receptor, calcium binding, Alternative splicing, Calcium channel, Calcium transport, Glycoprotein, Ion transport, Ionic channel, Membrane, Polymorphism, Transmembrane, Transport, Cytoplasm, Metal-binding, Zinc, METAL BINDING PROTEIN
Deposited on 2008-04-01, released 2008-07-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein S100-A1
  Species: Rattus norvegicus
  Gene: S100a1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35467 (0-92)
  Domains in SCOPe 2.06: d2k2fa_
• Chain 'B':
  Compound: Protein S100-A1
  Species: Rattus norvegicus
  Gene: S100a1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35467 (0-92)
  Domains in SCOPe 2.06: d2k2fb_
• Chain 'C':
  Compound: Ryanodine receptor 1 peptide
  Species: Rattus norvegicus
  Gene: RYR1
  Database cross-references and differences (RAF-indexed):
  • PDB 2K2F (0-11)
• Chain 'D':
  Compound: Ryanodine receptor 1 peptide
  Species: Rattus norvegicus
  Gene: RYR1
  Database cross-references and differences (RAF-indexed):
  • PDB 2K2F (0-11)
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k2fA (A:)
  gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
  ldengdgevdfqefvvlvaaltvacnnffwens
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k2fB (B:)
  gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
  ldengdgevdfqefvvlvaaltvacnnffwens
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.