PDB entry 2k2f

View 2k2f on RCSB PDB site
Description: Solution structure of Ca2+-S100A1-RyRP12
Class: metal binding protein
Keywords: S100, EF hand, ryanodine receptor, calcium binding, Alternative splicing, Calcium channel, Calcium transport, Glycoprotein, Ion transport, Ionic channel, Membrane, Polymorphism, Transmembrane, Transport, Cytoplasm, Metal-binding, Zinc, METAL BINDING PROTEIN
Deposited on 2008-04-01, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Rattus norvegicus
    Gene: S100a1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2k2fa_
  • Chain 'B':
    Compound: Protein S100-A1
    Species: Rattus norvegicus
    Gene: S100a1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2k2fb_
  • Chain 'C':
    Compound: Ryanodine receptor 1 peptide
    Species: Rattus norvegicus
    Gene: RYR1
    Database cross-references and differences (RAF-indexed):
    • PDB 2K2F (0-11)
  • Chain 'D':
    Compound: Ryanodine receptor 1 peptide
    Species: Rattus norvegicus
    Gene: RYR1
    Database cross-references and differences (RAF-indexed):
    • PDB 2K2F (0-11)
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k2fA (A:)
    gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
    ldengdgevdfqefvvlvaaltvacnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k2fB (B:)
    gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
    ldengdgevdfqefvvlvaaltvacnnffwens
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.