PDB entry 2k2c

View 2k2c on RCSB PDB site
Description: Solution NMR structure of N-terminal domain of human pirh2. Northeast Structural Genomics Consortium (NESG) target HT2A
Class: metal binding protein
Keywords: zinc-binding protein, Cytoplasm, Metal-binding, Nucleus, Zinc-finger, METAL BINDING PROTEIN, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2008-03-31, released 2008-04-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RING finger and CHY zinc finger domain-containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: RCHY1, ARNIP, CHIMP, PIRH2, RNF199, ZNF363
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96PM5 (0-136)
    • variant (10)
    • variant (12)
  Domains in SCOPe 2.04: d2k2ca1, d2k2ca2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k2cA (A:)
  maataredgatgeergqrgcehydrgcllkapccdklytcrlchdnnedhqldrfkvkev
  qcincekiqhaqqtceecstlfgeyycdichlfdkdkkqyhcencgicrigpkedffhcl
  kcnlclamnlqgrhkci