PDB entry 2k2a

View 2k2a on RCSB PDB site
Description: Solution Structure of the Apo C terminal domain of Lethocerus troponin C isoform F1
Class: contractile protein
Keywords: contractile protein, calcium binding protein
Deposited on 2008-03-29, released 2009-04-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c
  Species: Lethocerus indicus [TaxId:212017]
  Gene: tnC4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q868D4 (0-69)
  Domains in SCOPe 2.05: d2k2aa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k2aA (A:)
  mqqelreafrlydkegngyistdvmreilaeldetlssedldamideidadgsgtvdfee
  fmgvmtggde