PDB entry 2k28

View 2k28 on RCSB PDB site
Description: Solution NMR structure of the chromo domain of the chromobox protein homolog 4
Class: transcription
Keywords: alpha/beta protein, Alternative splicing, Chromatin regulator, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation, Ubl conjugation, Ubl conjugation pathway, Structural Genomics Consortium, SGC
Deposited on 2008-03-27, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 SUMO-protein ligase CBX4
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00257 (2-59)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2k28a1, d2k28a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k28A (A:)
    gsehvfavesiekkrirkgrveylvkwrgwspkyntwepeenildprlliafqnrerqeq